Loading...
Statistics
Advertisement

Simmytech.com

Advertisement
Conversion Technology Metas Server
Simmytech.com is hosted in United States / Austin . Simmytech.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Simmytech.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Simmytech.com

Missing HTTPS protocol.

    Meta - Simmytech.com

    Number of occurences: 2
    • Name: robots
      Content: noarchive
    • Name: googlebot
      Content: nosnippet

    Server / Hosting

    • IP: 209.99.40.223
    • Latitude: 30.32
    • Longitude: -97.88
    • Country: United States
    • City: Austin

    Rname

    • dns12.parkpage.foundationapi.com
    • dns11.parkpage.foundationapi.com

    Target

    • abuse.opticaljungle.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 13 Apr 2016 20:50:21 GMT Server: Apache Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8

    DNS

    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 209.99.40.223
    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: dns12.parkpage.foundationapi.com
    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: dns11.parkpage.foundationapi.com
    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: dns11.parkpage.foundationapi.com
    5. rname: abuse.opticaljungle.com
    6. serial: 2011062801
    7. refresh: 3600
    8. retry: 900
    9. expire: 604800
    10. minimum-ttl: 86400
    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: PTR
    4. target: dns11.parkpage.foundationapi.com
    host: simmytech.com
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 a -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.immytech.com, www.seimmytech.com, www.eimmytech.com, www.swimmytech.com, www.wimmytech.com, www.sdimmytech.com, www.dimmytech.com, www.sximmytech.com, www.ximmytech.com, www.sfimmytech.com, www.fimmytech.com, www.sgimmytech.com, www.gimmytech.com, www.stimmytech.com, www.timmytech.com, www.smmytech.com, www.sirmmytech.com, www.srmmytech.com, www.sifmmytech.com, www.sfmmytech.com, www.sivmmytech.com, www.svmmytech.com, www.sikmmytech.com, www.skmmytech.com, www.si,mmytech.com, www.s,mmytech.com, www.sibmmytech.com, www.sbmmytech.com, www.sigmmytech.com, www.sgmmytech.com, www.sitmmytech.com, www.stmmytech.com, www.siymmytech.com, www.symmytech.com, www.siummytech.com, www.summytech.com, www.sijmmytech.com, www.sjmmytech.com, www.simmmytech.com, www.smmmytech.com, www.sinmmytech.com, www.snmmytech.com, www.simytech.com, www.simpmytech.com, www.sipmytech.com, www.simomytech.com, www.siomytech.com, www.simimytech.com, www.siimytech.com, www.simkmytech.com, www.sikmytech.com, www.sim.mytech.com, www.si.mytech.com, www.simumytech.com, www.siumytech.com, www.simjmytech.com, www.sijmytech.com, www.simnmytech.com, www.sinmytech.com, www.sim-mytech.com, www.si-mytech.com, www.simytech.com, www.simmpytech.com, www.simpytech.com, www.simmoytech.com, www.simoytech.com, www.simmiytech.com, www.simiytech.com, www.simmkytech.com, www.simkytech.com, www.simm.ytech.com, www.sim.ytech.com, www.simmuytech.com, www.simuytech.com, www.simmjytech.com, www.simjytech.com, www.simmnytech.com, www.simnytech.com, www.simm-ytech.com, www.sim-ytech.com, www.simmtech.com, www.simmyztech.com, www.simmztech.com, www.simmyatech.com, www.simmatech.com, www.simmystech.com, www.simmstech.com, www.simmydtech.com, www.simmdtech.com, www.simmytech.com, www.simmtech.com, www.simmyctech.com, www.simmctech.com, www.simmy tech.com, www.simm tech.com, www.simmyech.com, www.simmytqech.com, www.simmyqech.com, www.simmytaech.com, www.simmyaech.com, www.simmyt ech.com, www.simmy ech.com, www.simmytwech.com, www.simmywech.com, www.simmyteech.com, www.simmyeech.com, www.simmytzech.com, www.simmyzech.com, www.simmytxech.com, www.simmyxech.com, www.simmytcech.com, www.simmycech.com, www.simmytch.com, www.simmytexch.com, www.simmytxch.com, www.simmytesch.com, www.simmytsch.com, www.simmytewch.com, www.simmytwch.com, www.simmyterch.com, www.simmytrch.com, www.simmytefch.com, www.simmytfch.com, www.simmytevch.com, www.simmytvch.com, www.simmytecch.com, www.simmytcch.com, www.simmyteqch.com, www.simmytqch.com, www.simmyteach.com, www.simmytach.com, www.simmyteych.com, www.simmytych.com, www.simmyteh.com, www.simmytecdh.com, www.simmytedh.com, www.simmytecrh.com, www.simmyterh.com, www.simmytecth.com, www.simmyteth.com, www.simmytecvh.com, www.simmytevh.com, www.simmytecfh.com, www.simmytefh.com, www.simmytecgh.com, www.simmytegh.com, www.simmytechh.com, www.simmytehh.com, www.simmytecnh.com, www.simmytenh.com, www.simmytecmh.com, www.simmytemh.com, www.simmytecjh.com, www.simmytejh.com, www.simmytec.com, www.simmyteche.com, www.simmytece.com, www.simmytechd.com, www.simmytecd.com, www.simmytechc.com, www.simmytecc.com, www.simmytechu.com, www.simmytecu.com, www.simmytechj.com, www.simmytecj.com, www.simmytech.com, www.simmytec.com, www.simmytechb.com, www.simmytecb.com, www.simmytechg.com, www.simmytecg.com,

    Other websites we recently analyzed

    1. win win lening
      London (United Kingdom) - 89.187.86.129
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: CSS, Html, Php
      Number of meta tags: 3
    2. Carina Verhulst Persoonlijk Leiderschap & Organisatieontwikkeling
      Netherlands - 217.21.241.234
      Server software: squid/3.5.19
      Technology: Html, Php
    3. Myke Walker's Website
      Lake Mary (United States) - 208.94.116.143
      Server software: Apache
      Technology: CSS, Fancybox, Html, Javascript, jQuery Fancybox, Php
      Number of Javascript: 10
      Number of meta tags: 4
    4. Riccione mare.it: i nostri Hotel fronte mare nel centro di Riccione per vacanze e weekend sulla spiaggia
      Riccione Mare è il portale per le Sue vacanze ed i Suoi weekend a Riccione: presenta hotel di Riccione 3 e 4 stelle sul mare e nel centro a Riccione, ed i servizi di ospitalità del Gruppo Atlantic
      Italy - 217.70.144.128
      Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 PHP/5.4.31
      Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 3
    5. resideceondablu.es
      France - 94.23.200.8
      Server software: nginx
      Technology: Html
      Number of meta tags: 1
    6. Stile Grafico - Lissone - Monza
      Stile Grafico da oltre 20 anni opera nella provincia di Monza nel settore della comunicazione grafica visiva con professionalità e riconosciuta esperienza.
      Milan (Italy) - 212.48.12.143
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
      Number of Javascript: 39
      Number of meta tags: 5
    7. karton22.ru
      Russian Federation - 82.146.43.141
      Server software: Apache/2.4.10 (Debian)
      Technology: Html
    8. electricknifesharpenerreviews.com
      Frankfurt (Germany) - 149.126.77.93
      Server software:
      Technology: Html, Iframe, Incapsula, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    9. injunctionagainstharassment.com
      Scottsdale (United States) - 50.63.202.51
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. MarketSurf by Stella MORABITO
      Mountain View (United States) - 172.217.22.51
      Server software: GSE
      Technology: CSS, Feedburner, Html, Javascript, Php, Geovisite, Google +1 Button
      Number of Javascript: 7
      Number of meta tags: 2

    Check Other Websites